PCGF1 Peptide - middle region
PCGF1 Peptide - middle region
Product Specifications
Product Name Alternative
2010002K04Rik, FLJ43754, MGC10882, NSPC1, RNF3A-2, RNF68
UniProt
Q9BSM1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PCGF1 Rabbit Polyclonal Antibody (orb578806) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_116062
Preservative
Lyophilized powder
AA Sequence
PALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYV
More Discoveries
Explore Other Products
Browse additional items from our catalog
492341 100 µL
SMPD2 (Sphingomyelin Phosphodiesterase 2, Sphingomyelin Phosphodiesterase 2, Neutral Membrane (Neutral Sphingomyelinase) )
Sign In for Pricing
View Details 
orb2973736-01 50 Tests
CD184/CXCR4 Human Monoclonal Antibody (FITC)
Sign In for Pricing
View Details 
orb2973736-02 100 Tests
CD184/CXCR4 Human Monoclonal Antibody (FITC)
Sign In for Pricing
View Details