Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCGF6 Peptide - middle region

PCGF6 Peptide - middle region

Product Specifications

Product Name Alternative

MBLR, MGC15678, MGC17541, RNF134

UniProt

Q9BYE7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCGF6 Rabbit Polyclonal Antibody (orb578798) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115530

Preservative

Lyophilized powder

AA Sequence

TQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human cellular fibronectin, cFn ELISA kit
CK-bio-10818-01 48 Tests

Human cellular fibronectin, cFn ELISA kit

Sign In for Pricing
View Details
Human cellular fibronectin, cFn ELISA kit
CK-bio-10818-02 96 Tests

Human cellular fibronectin, cFn ELISA kit

Sign In for Pricing
View Details
Human cellular fibronectin, cFn ELISA kit
CK-bio-10818-03 5x 96 Tests

Human cellular fibronectin, cFn ELISA kit

Sign In for Pricing
View Details
Human cellular fibronectin, cFn ELISA kit
CK-bio-10818-04 10x 96 Tests

Human cellular fibronectin, cFn ELISA kit

Sign In for Pricing
View Details
Rabbit Polyclonal FAM149B1 Antibody [DyLight 350]
NBP3-06311UV 0.1 mL

Rabbit Polyclonal FAM149B1 Antibody [DyLight 350]

Sign In for Pricing
View Details
USP14 Over-expression Lysate Product
GWB-2288E1 0.1 mg

USP14 Over-expression Lysate Product

Sign In for Pricing
View Details