Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCGF6 Peptide - middle region

PCGF6 Peptide - middle region

Product Specifications

Product Name Alternative

MBLR, MGC15678, MGC17541, RNF134

UniProt

Q9BYE7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCGF6 Rabbit Polyclonal Antibody (orb578798) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115530

Preservative

Lyophilized powder

AA Sequence

TQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Indobufen
C6492-25 25 mg

Indobufen

Sign In for Pricing
View Details
Giemsa stain solution for microscopy
1092ML500 500 mL

Giemsa stain solution for microscopy

Sign In for Pricing
View Details
POPDC2 siRNA (Human)
CRJ1912-01 15 nmol

POPDC2 siRNA (Human)

Sign In for Pricing
View Details
POPDC2 siRNA (Human)
CRJ1912-02 30 nmol

POPDC2 siRNA (Human)

Sign In for Pricing
View Details
Sgms1 (NM_001168526) Mouse Tagged Lenti ORF Clone
MR216921L3 10 µg

Sgms1 (NM_001168526) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
H2-Eb2 CRISPR Activation Plasmid (m2)
sc-436241-ACT-2 20 µg

H2-Eb2 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details