Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pde2a Peptide - N-terminal region

Pde2a Peptide - N-terminal region

Product Specifications

Product Name Alternative

Pde2, Pde2a2, Pde2a

UniProt

Q01062

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pde2a Rabbit Polyclonal Antibody (orb583134) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001137319

Preservative

Lyophilized powder

AA Sequence

CRSQQYPAARPAEPRGQQVFLKPDEPPPQPCADSLQDALLSLGAVIDIAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MVB12B (NM_001011703) AAV Particle
RC205093A1V 250 µL

Human MVB12B (NM_001011703) AAV Particle

Sign In for Pricing
View Details
RCN2 Antibody
OACD06952-100UL 100 µL

RCN2 Antibody

Sign In for Pricing
View Details
PYCR1 Antibody (C-term) [AMR09665G]
AMR09665G-01 50 µL

PYCR1 Antibody (C-term) [AMR09665G]

Sign In for Pricing
View Details
PYCR1 Antibody (C-term) [AMR09665G]
AMR09665G-02 100 µL

PYCR1 Antibody (C-term) [AMR09665G]

Sign In for Pricing
View Details
PYCR1 Antibody (C-term) [AMR09665G]
AMR09665G-03 200 µL

PYCR1 Antibody (C-term) [AMR09665G]

Sign In for Pricing
View Details
PYCR1 Antibody (C-term) [AMR09665G]
AMR09665G-04 400 µL

PYCR1 Antibody (C-term) [AMR09665G]

Sign In for Pricing
View Details