Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pde4b Peptide - N-terminal region

Pde4b Peptide - N-terminal region

Product Specifications

Product Name Alternative

Dpde4, R74983, dunce

UniProt

Q9QXI7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pde4b Rabbit Polyclonal Antibody (orb330834) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062814

Preservative

Lyophilized powder

AA Sequence

LVNKSIRQRRRFTVAHTCFDVENGPSPGRSPLDPQAGSSSGLVLHAAFPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIMPII (SCARB2) (NM_001204255) Human Tagged ORF Clone
RC233803 10 µg

LIMPII (SCARB2) (NM_001204255) Human Tagged ORF Clone

Sign In for Pricing
View Details
LOC642316 Human shRNA Plasmid Kit (Locus ID 642316)
TR319618 1 Kit

LOC642316 Human shRNA Plasmid Kit (Locus ID 642316)

Sign In for Pricing
View Details
Snrpn ORF Vector (Rat) (pORF)
45008016 1.0 µg DNA

Snrpn ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
LONRF1 Rabbit pAb
E45R20984N-100 100 µL

LONRF1 Rabbit pAb

Sign In for Pricing
View Details
Anti-Omalizumab Non-Neutralizing Recombinant Antibody (SAA2620)
AV064023-01 50 µg

Anti-Omalizumab Non-Neutralizing Recombinant Antibody (SAA2620)

Sign In for Pricing
View Details
Anti-Omalizumab Non-Neutralizing Recombinant Antibody (SAA2620)
AV064023-02 100 µg

Anti-Omalizumab Non-Neutralizing Recombinant Antibody (SAA2620)

Sign In for Pricing
View Details