Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pde4b Peptide - N-terminal region

Pde4b Peptide - N-terminal region

Product Specifications

Product Name Alternative

Dpde4, R74983, dunce

UniProt

Q9QXI7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pde4b Rabbit Polyclonal Antibody (orb330834) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062814

Preservative

Lyophilized powder

AA Sequence

LVNKSIRQRRRFTVAHTCFDVENGPSPGRSPLDPQAGSSSGLVLHAAFPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRp20 CRISPR Activation Plasmid (h2)
sc-401265-ACT-2 20 µg

SRp20 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Mouse IgG Isotype Control
PA1394-1 1 mL

Mouse IgG Isotype Control

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS707550 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Recombinant Grammostola rosea Beta-theraphotoxin-Gr1a
MBS1086604-01 0.05 mg (E-Coli)

Recombinant Grammostola rosea Beta-theraphotoxin-Gr1a

Sign In for Pricing
View Details
Recombinant Grammostola rosea Beta-theraphotoxin-Gr1a
MBS1086604-02 0.2 mg (E-Coli)

Recombinant Grammostola rosea Beta-theraphotoxin-Gr1a

Sign In for Pricing
View Details
Recombinant Grammostola rosea Beta-theraphotoxin-Gr1a
MBS1086604-03 0.05 mg (Yeast)

Recombinant Grammostola rosea Beta-theraphotoxin-Gr1a

Sign In for Pricing
View Details