Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pde4d Peptide - N-terminal region

Pde4d Peptide - N-terminal region

Product Specifications

Product Name Alternative

9630011N22Rik, Dpde3

UniProt

Q01063

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pde4d Rabbit Polyclonal Antibody (orb583257) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035186

Preservative

Lyophilized powder

AA Sequence

PFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RB (B-Cell Marker) (rPTPRC/1132), CF568 conjugate, 0.1mg/mL
BNC683461-500 1x 500 µL

CD45RB (B-Cell Marker) (rPTPRC/1132), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ITPA Recombinant Rabbit Monoclonal Antibody [JE61-67]
HA720093 100 µL

ITPA Recombinant Rabbit Monoclonal Antibody [JE61-67]

Sign In for Pricing
View Details
AKT1 (Prognostic Marker for Neuroendocrine Tumors) (rAKT1/2491), CF594 conjugate, 0.1mg/mL
BNC943786-100 1x 100 µL

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (rAKT1/2491), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Trimebutine Maleate Salt
TRC-T795605-5G 5 g

Trimebutine Maleate Salt

Sign In for Pricing
View Details
Human Peroxisome Proliferator Activated Receptor Gamma (PPARg) ELISA Kit
RDR-PPARg-Hu-01 96 Tests

Human Peroxisome Proliferator Activated Receptor Gamma (PPARg) ELISA Kit

Sign In for Pricing
View Details
Human Peroxisome Proliferator Activated Receptor Gamma (PPARg) ELISA Kit
RDR-PPARg-Hu-02 48 Tests

Human Peroxisome Proliferator Activated Receptor Gamma (PPARg) ELISA Kit

Sign In for Pricing
View Details