Pde4d Peptide - N-terminal region
Pde4d Peptide - N-terminal region
Product Specifications
Product Name Alternative
9630011N22Rik, Dpde3
UniProt
Q01063
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Pde4d Rabbit Polyclonal Antibody (orb583257) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_035186
Preservative
Lyophilized powder
AA Sequence
PFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP06360PU-N 100 µg
VEGF Receptor 2 (KDR) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
LC403545 20 µg
NFAT2 (NFATC1) (NM_172390) Human Over-expression Lysate
Sign In for Pricing
View Details 
E-AB-V1128-01 20 µL
Anti-Ebola virus EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Nucleoprotein/NP Polyclonal Antibody
Sign In for Pricing
View Details E-AB-V1128-02 100 µL
Anti-Ebola virus EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Nucleoprotein/NP Polyclonal Antibody
Sign In for Pricing
View Details ![PNPO Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F8]](https://cdn.genprice.uk/products/937/6868c34d994c49e6dc3f3689/imageurl/ta503178bm.webp)
TA503178BM 100 µL
PNPO Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F8]
Sign In for Pricing
View Details 