Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDIA3 Peptide - C-terminal region

PDIA3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ER60, ERp57, ERp60, ERp61, GRP57, GRP58, HsT17083, P58, PI-PLC

UniProt

P30101

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDIA3 Rabbit Polyclonal Antibody (orb585694) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, IP, WB

NCBI Accession Number

NP_005304

Preservative

Lyophilized powder

AA Sequence

YFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVIQEEKPKKKKKAQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Poly (DL-lactide co-Caprolactone), 40:60, IV 0.80 dL/g, Powder
50373-5 5 g

Poly (DL-lactide co-Caprolactone), 40:60, IV 0.80 dL/g, Powder

Sign In for Pricing
View Details
Rabbit Polyclonal GLI-3 Antibody [Alexa Fluor 750]
NBP2-29627AF750 0.1 mL

Rabbit Polyclonal GLI-3 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Rabbit Polyclonal TRMT12 Antibody
NBP2-88484 100 µL

Rabbit Polyclonal TRMT12 Antibody

Sign In for Pricing
View Details
PE Rabbit anti-Mouse CD38 mAb
A26393-01 50 Tests

PE Rabbit anti-Mouse CD38 mAb

Sign In for Pricing
View Details
PE Rabbit anti-Mouse CD38 mAb
A26393-02 100 Tests

PE Rabbit anti-Mouse CD38 mAb

Sign In for Pricing
View Details
PE Rabbit anti-Mouse CD38 mAb
A26393-03 200 Tests

PE Rabbit anti-Mouse CD38 mAb

Sign In for Pricing
View Details