Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDIA3 Peptide - C-terminal region

PDIA3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ER60, ERp57, ERp60, ERp61, GRP57, GRP58, HsT17083, P58, PI-PLC

UniProt

P30101

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDIA3 Rabbit Polyclonal Antibody (orb585694) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, IP, WB

NCBI Accession Number

NP_005304

Preservative

Lyophilized powder

AA Sequence

YFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVIQEEKPKKKKKAQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acbd3 ORF Vector (Rat) (pORF)
ORF062932 1.0 µg DNA

Acbd3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
GL Antibody (Biotin)
orb242368-01 50 µg

GL Antibody (Biotin)

Sign In for Pricing
View Details
GL Antibody (Biotin)
orb242368-02 100 µg

GL Antibody (Biotin)

Sign In for Pricing
View Details
Tdh (NM_021480) Mouse Tagged ORF Clone
MG205787 10 µg

Tdh (NM_021480) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CSF2RA Antibody - C-terminal region (ARP64561_P050)
ARP64561_P050 100 µL

CSF2RA Antibody - C-terminal region (ARP64561_P050)

Sign In for Pricing
View Details
PS2 Antibody / TFF1
orb606848-01 20 µg

PS2 Antibody / TFF1

Sign In for Pricing
View Details