Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDLIM1 Peptide - C-terminal region

PDLIM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLIM1, CLP-36, CLP36, hCLIM1

UniProt

O00151

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDLIM1 Rabbit Polyclonal Antibody (orb585148) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066272

Preservative

Lyophilized powder

AA Sequence

FLVLQEILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC5D sgRNA CRISPR Lentivector (Human) (Target 2)
K2588503 1.0 µg DNA

UNC5D sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
FABP4
pro-1568 2µg

FABP4

Sign In for Pricing
View Details
Goat Tumor Necrosis Factor Receptor Superfamily, Member 1A ELISA Kit
MBS7260088-01 48 Well

Goat Tumor Necrosis Factor Receptor Superfamily, Member 1A ELISA Kit

Sign In for Pricing
View Details
Goat Tumor Necrosis Factor Receptor Superfamily, Member 1A ELISA Kit
MBS7260088-02 96 Well

Goat Tumor Necrosis Factor Receptor Superfamily, Member 1A ELISA Kit

Sign In for Pricing
View Details
Goat Tumor Necrosis Factor Receptor Superfamily, Member 1A ELISA Kit
MBS7260088-03 5x 96 Well

Goat Tumor Necrosis Factor Receptor Superfamily, Member 1A ELISA Kit

Sign In for Pricing
View Details
Goat Tumor Necrosis Factor Receptor Superfamily, Member 1A ELISA Kit
MBS7260088-04 10x 96 Well

Goat Tumor Necrosis Factor Receptor Superfamily, Member 1A ELISA Kit

Sign In for Pricing
View Details