Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDLIM1 Peptide - C-terminal region

PDLIM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLIM1, CLP-36, CLP36, hCLIM1

UniProt

O00151

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDLIM1 Rabbit Polyclonal Antibody (orb585148) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066272

Preservative

Lyophilized powder

AA Sequence

FLVLQEILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mrpl37 (NM_025500) AAV Particle
MR206731A1V 250 µL

Mouse Mrpl37 (NM_025500) AAV Particle

Sign In for Pricing
View Details
Human Monoclonal Angiopoietin-2 Antibody (Roche patent anti-ANG-2) [Alexa Fluor 488]
NBP3-27955AF488 0.1 mL

Human Monoclonal Angiopoietin-2 Antibody (Roche patent anti-ANG-2) [Alexa Fluor 488]

Sign In for Pricing
View Details
CEP55 (C-4) FITC
sc-377018 FITC 200 µg/mL

CEP55 (C-4) FITC

Sign In for Pricing
View Details
Cyp2c67 Mouse Gene Knockout Kit (CRISPR)
KN504125 1 Kit

Cyp2c67 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli arp Polyclonal Antibody
MBS7152938 Inquire

Rabbit anti-Escherichia coli arp Polyclonal Antibody

Sign In for Pricing
View Details
ELISA Kit For Serpin B3
E1372h 96 Tests

ELISA Kit For Serpin B3

Sign In for Pricing
View Details