Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDP2 Peptide - middle region

PDP2 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA1348, PPM2C2

UniProt

Q9P2J9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDP2 Rabbit Polyclonal Antibody (orb326206) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065837

Preservative

Lyophilized powder

AA Sequence

LQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PP,500ml, narrow mouth, transparent
SJP-500ZT-PP 10pcs/bag, 10bags/ctn

PP,500ml, narrow mouth, transparent

Sign In for Pricing
View Details
RBM7 Rabbit Polyclonal Antibody
orb258279 100 µg

RBM7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VDAC1 Antibody
F49743-0.08ML 0.08 mL

VDAC1 Antibody

Sign In for Pricing
View Details
RCOR2 Rabbit Polyclonal Antibody
orb575197 100 µL

RCOR2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Smad2/3 Polyclonal Antibody
MBS9409235-01 0.05 mL

Smad2/3 Polyclonal Antibody

Sign In for Pricing
View Details
Smad2/3 Polyclonal Antibody
MBS9409235-02 0.1 mL

Smad2/3 Polyclonal Antibody

Sign In for Pricing
View Details