Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDP2 Peptide - middle region

PDP2 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA1348, PPM2C2

UniProt

Q9P2J9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDP2 Rabbit Polyclonal Antibody (orb326206) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065837

Preservative

Lyophilized powder

AA Sequence

LQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-METTL17 Antibody Picoband® Fluoro488 Conjugated
A14339-1-Fluoro488 100 µg/Vial

Anti-METTL17 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
NTRK3 Blocking Peptide (Center)
MBS9229665-01 0.5 mg

NTRK3 Blocking Peptide (Center)

Sign In for Pricing
View Details
NTRK3 Blocking Peptide (Center)
MBS9229665-02 5x 0.5 mg

NTRK3 Blocking Peptide (Center)

Sign In for Pricing
View Details
FABP4 Antibody
orb3161377-01 50 µL

FABP4 Antibody

Sign In for Pricing
View Details
FABP4 Antibody
orb3161377-02 100 µL

FABP4 Antibody

Sign In for Pricing
View Details
Genesig kit for Borrelia burgdorferi, Easy
348344 1 Kit

Genesig kit for Borrelia burgdorferi, Easy

Sign In for Pricing
View Details