Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pdx1 Peptide - N-terminal region

Pdx1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

IDX-1, IPF-1, Ipf1, Mody4, STF-1, pdx-1

UniProt

P52946

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pdx1 Rabbit Polyclonal Antibody (orb574003) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032840

Preservative

Lyophilized powder

AA Sequence

LYMGRQPPPPPPPQFTSSLGSLEQGSPPDISPYEVPPLASDDPAGAHLHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GR/NR3C1 Overexpression Lysate (Native) - (Dry Ice)
NBP2-11025 0.1 mg

GR/NR3C1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Mtus1 (NM_001005865) Mouse Tagged ORF Clone
MR224650 10 µg

Mtus1 (NM_001005865) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
HLCS CRISPR Activation Plasmid (m)
sc-431072-ACT 20 µg

HLCS CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Lentiviral mouse Ing2 shRNA (UAS) - Lentiviral mouse Ing2 shRNA (UAS, RFP) (100)
GTR15235680 1 Vial

Lentiviral mouse Ing2 shRNA (UAS) - Lentiviral mouse Ing2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Canine Olfactory receptor 6C6 (OR6C6) ELISA Kit
MBS7239305-01 48 Well

Canine Olfactory receptor 6C6 (OR6C6) ELISA Kit

Sign In for Pricing
View Details
Canine Olfactory receptor 6C6 (OR6C6) ELISA Kit
MBS7239305-02 96 Well

Canine Olfactory receptor 6C6 (OR6C6) ELISA Kit

Sign In for Pricing
View Details