Pdx1 Peptide - N-terminal region
Pdx1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
IDX-1, IPF-1, Ipf1, Mody4, STF-1, pdx-1
UniProt
P52946
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Pdx1 Rabbit Polyclonal Antibody (orb574003) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_032840
Preservative
Lyophilized powder
AA Sequence
LYMGRQPPPPPPPQFTSSLGSLEQGSPPDISPYEVPPLASDDPAGAHLHH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Cr7089-500gEcoli 500 µg (E. coli)
Recombinant Pasteurella Multocida PM0519 Protein (aa 1-114)
Sign In for Pricing
View Details 
MBS6363891-01 0.1 mL
Xaf1, ID (Xaf1, Birc4bp, Xiapaf1, XIAP-associated factor 1, BIRC4-binding protein) (MaxLight 490)
Sign In for Pricing
View Details MBS6363891-02 5x 0.1 mL
Xaf1, ID (Xaf1, Birc4bp, Xiapaf1, XIAP-associated factor 1, BIRC4-binding protein) (MaxLight 490)
Sign In for Pricing
View Details 
GTR15264198 1 Vial
Lentiviral mouse Rab1a shRNA (UAS) - Lentiviral mouse Rab1a shRNA (UAS) (100)
Sign In for Pricing
View Details