PELP1 Peptide - C-terminal region
PELP1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
HMX3, MNAR, P160
UniProt
Q8IZL8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PELP1 Rabbit Polyclonal Antibody (orb585073) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055204
Preservative
Lyophilized powder
AA Sequence
APSGTPPPTIPPDETFGGRVPRPAFVHYDKEEASDVEISLESDSDDSVVI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Lsx06506-50gEcoli 50 µg (E. coli)
Recombinant Mycoplasma Hyopneumoniae proS Protein (aa 1-479) (strain 232)
Sign In for Pricing
View Details 24188116 3x 1.0 µg
Idh2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
Sign In for Pricing
View Details 038137-Biotin 200 µL
MAP3K1, phosphorylated (T1383) (MAP3K1, MAPKKK1, MEKK, MEKK1, Mitogen-activated protein kinase kinase kinase 1, MAPK/ERK kinase kinase 1) (Biotin) discontinued
Sign In for Pricing
View Details 