Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PELP1 Peptide - C-terminal region

PELP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HMX3, MNAR, P160

UniProt

Q8IZL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PELP1 Rabbit Polyclonal Antibody (orb585073) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055204

Preservative

Lyophilized powder

AA Sequence

APSGTPPPTIPPDETFGGRVPRPAFVHYDKEEASDVEISLESDSDDSVVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goose viscus tissue Neutrophils Isolation Kit
P2300 200 mL/Kit

Goose viscus tissue Neutrophils Isolation Kit

Sign In for Pricing
View Details
PHF14 Human qPCR Primer Pair (NM_001007157)
HP201782 200 Reactions

PHF14 Human qPCR Primer Pair (NM_001007157)

Sign In for Pricing
View Details
PYGL Antibody
orb239960-01 50 µg

PYGL Antibody

Sign In for Pricing
View Details
PYGL Antibody
orb239960-02 100 µg

PYGL Antibody

Sign In for Pricing
View Details
Anti-NGF Antibody (1V140)
TMAY-01544 100 µL

Anti-NGF Antibody (1V140)

Sign In for Pricing
View Details
Innovative Grade US Origin Bovine Gland Adrenal Fresh in Saline Single Gland
IGBOGLARSX1 1 Each

Innovative Grade US Origin Bovine Gland Adrenal Fresh in Saline Single Gland

Sign In for Pricing
View Details