Pepd Peptide - middle region
Pepd Peptide - middle region
Product Specifications
Product Name Alternative
Pep-4, Pep4
UniProt
Q11136
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Pepd Rabbit Polyclonal Antibody (orb582993) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_032846
Preservative
Lyophilized powder
AA Sequence
YSRGGMRHTSYTCICCSGENAAVLHYGHAGAPNDRTIKDGDICLFDMGGE
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS618560-01 0.1 mL
ROR2 (Receptor Tyrosine Kinase-like Orphan Receptor 2, BDB, BDB1, MGC163394, Neurotrophic Tyrosine Kinase, Receptor-related 2, NTRKR2, Tyrosine-protein Kinase Transmembrane Receptor ROR2)
Sign In for Pricing
View Details 
MBS618560-02 5x 0.1 mL
ROR2 (Receptor Tyrosine Kinase-like Orphan Receptor 2, BDB, BDB1, MGC163394, Neurotrophic Tyrosine Kinase, Receptor-related 2, NTRKR2, Tyrosine-protein Kinase Transmembrane Receptor ROR2)
Sign In for Pricing
View Details 
ELK9367-01 48 Tests
Human OLIG2 (Oligodendrocyte Lineage Transcription Factor 2) ELISA Kit
Sign In for Pricing
View Details