Pepd Peptide - middle region
Pepd Peptide - middle region
Product Specifications
Product Name Alternative
Pep-4, Pep4
UniProt
Q11136
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Pepd Rabbit Polyclonal Antibody (orb582993) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_032846
Preservative
Lyophilized powder
AA Sequence
YSRGGMRHTSYTCICCSGENAAVLHYGHAGAPNDRTIKDGDICLFDMGGE
More Discoveries
Explore Other Products
Browse additional items from our catalog
22619121 3x 1.0µg DNA
GPX1 CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details 
APG02802G 0.1mg
Monoclonal CRYAB / Alpha B Crystallin Antibody (clone 1A7.D5), Clone: 1A7.D5
Sign In for Pricing
View Details 
ARP43389_P050-FITC 100 µL
RSPRY1 Antibody - N-terminal region : FITC (ARP43389_P050-FITC)
Sign In for Pricing
View Details 