Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEX19 Peptide - C-terminal region

PEX19 Peptide - C-terminal region

Product Specifications

Product Name Alternative

D1S2223E, FLJ55296, HK33, PMP1, PMPI, PXF, PXMP1

UniProt

P40855

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PEX19 Rabbit Polyclonal Antibody (orb585051) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002848

Preservative

Lyophilized powder

AA Sequence

AETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tssk5 ORF Vector (Rat) (pORF)
ORF078361 1.0 µg DNA

Tssk5 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Recombinant SARS-CoV-2/COVID-19 S1 Protein
E40COV401 50 µg

Recombinant SARS-CoV-2/COVID-19 S1 Protein

Sign In for Pricing
View Details
GTF2H2 Protein Lysate
OCOA14561-20UG 20 µg

GTF2H2 Protein Lysate

Sign In for Pricing
View Details
HindIII, recombinant
R0104L 50000 Units

HindIII, recombinant

Sign In for Pricing
View Details
Mouse Acetyl Coenzyme A Carboxylase Alpha (ACACa) ELISA Kit
DLR-ACACa-Mu-48T 48 Tests

Mouse Acetyl Coenzyme A Carboxylase Alpha (ACACa) ELISA Kit

Sign In for Pricing
View Details
Semaphorin 3F Rabbit Polyclonal Antibody (PE-Cy7)
orb971735 100 µL

Semaphorin 3F Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details