Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEX19 Peptide - C-terminal region

PEX19 Peptide - C-terminal region

Product Specifications

Product Name Alternative

D1S2223E, FLJ55296, HK33, PMP1, PMPI, PXF, PXMP1

UniProt

P40855

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PEX19 Rabbit Polyclonal Antibody (orb585051) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002848

Preservative

Lyophilized powder

AA Sequence

AETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SERPINB10 / Serpin B10 Recombinant Protein
MBS2902685 Inquire

Human SERPINB10 / Serpin B10 Recombinant Protein

Sign In for Pricing
View Details
SHANK1 Antibody - C-terminal region
OAGA03010-100UL 100 µL

SHANK1 Antibody - C-terminal region

Sign In for Pricing
View Details
PEG10 (NM_015068) Human Tagged ORF Clone Lentiviral Particle
RC223371L4V 200 µL

PEG10 (NM_015068) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MLL5 Protein Vector (Mouse) (pPM-C-His)
PV201113 500 ng

MLL5 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Human NRG2 (Neuregulin 2) Microsample ELISA Kit
ELK3345MS-01 48 Tests

Human NRG2 (Neuregulin 2) Microsample ELISA Kit

Sign In for Pricing
View Details
Human NRG2 (Neuregulin 2) Microsample ELISA Kit
ELK3345MS-02 96 Tests

Human NRG2 (Neuregulin 2) Microsample ELISA Kit

Sign In for Pricing
View Details