Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pex2 Peptide - C-terminal region

Pex2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1700016J08Rik, PXR2, Pex2, TRIP8b

UniProt

Q8C437

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pex2 Rabbit Polyclonal Antibody (orb583374) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067458

Preservative

Lyophilized powder

AA Sequence

QRKSRNQQQVPHPAISGNIWAALRIALSLMDQPELFQAANLGDLDVLLRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR3E 3'UTR GFP Stable Cell Line
TU068440 1.0 mL

POLR3E 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
NSC-319726
9439-25 25 mg

NSC-319726

Sign In for Pricing
View Details
TGF beta 2 Propeptide
MBS8578446-01 0.1 mL

TGF beta 2 Propeptide

Sign In for Pricing
View Details
TGF beta 2 Propeptide
MBS8578446-02 0.1 mL (AF405L)

TGF beta 2 Propeptide

Sign In for Pricing
View Details
TGF beta 2 Propeptide
MBS8578446-03 0.1 mL (AF405S)

TGF beta 2 Propeptide

Sign In for Pricing
View Details
TGF beta 2 Propeptide
MBS8578446-04 0.1 mL (AF610)

TGF beta 2 Propeptide

Sign In for Pricing
View Details