Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PFDN4 Peptide - N-terminal region

PFDN4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C1, PFD4

UniProt

Q9NQP4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PFDN4 Rabbit Polyclonal Antibody (orb585310) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002614

Preservative

Lyophilized powder

AA Sequence

ATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Keratin, type II cytoskeletal 7, KRT7 ELISA Kit
MBS9330480-01 48 Well

Rat Keratin, type II cytoskeletal 7, KRT7 ELISA Kit

Sign In for Pricing
View Details
Rat Keratin, type II cytoskeletal 7, KRT7 ELISA Kit
MBS9330480-02 96 Well

Rat Keratin, type II cytoskeletal 7, KRT7 ELISA Kit

Sign In for Pricing
View Details
Rat Keratin, type II cytoskeletal 7, KRT7 ELISA Kit
MBS9330480-03 5x 96 Well

Rat Keratin, type II cytoskeletal 7, KRT7 ELISA Kit

Sign In for Pricing
View Details
Rat Keratin, type II cytoskeletal 7, KRT7 ELISA Kit
MBS9330480-04 10x 96 Well

Rat Keratin, type II cytoskeletal 7, KRT7 ELISA Kit

Sign In for Pricing
View Details
Rabbit Conjunctival Epithelial Primary Cells
CC7F828 5x 10^5 Cells/Vial

Rabbit Conjunctival Epithelial Primary Cells

Sign In for Pricing
View Details
P815 Lysate
MBS151713-01 0.1 mg

P815 Lysate

Sign In for Pricing
View Details