Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pfkfb2 Peptide - C-terminal region

Pfkfb2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4930568D07Rik

UniProt

Q6GTL7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pfkfb2 Rabbit Polyclonal Antibody (orb330878) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032851

Preservative

Lyophilized powder

AA Sequence

EMTYSEIEQRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIV-1 gag Protein p24 (137-154)
M41279-01 100 mg

HIV-1 gag Protein p24 (137-154)

Sign In for Pricing
View Details
HIV-1 gag Protein p24 (137-154)
M41279-02 25 mg

HIV-1 gag Protein p24 (137-154)

Sign In for Pricing
View Details
HIV-1 gag Protein p24 (137-154)
M41279-03 50 mg

HIV-1 gag Protein p24 (137-154)

Sign In for Pricing
View Details
HIV-1 gag Protein p24 (137-154)
M41279-04 500 mg

HIV-1 gag Protein p24 (137-154)

Sign In for Pricing
View Details
HIV-1 gag Protein p24 (137-154)
M41279-05 Inquire

HIV-1 gag Protein p24 (137-154)

Sign In for Pricing
View Details
SLC22A1 Antibody
orb2678486-01 50 µL

SLC22A1 Antibody

Sign In for Pricing
View Details