Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGAM1 Peptide - C-terminal region

PGAM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PGAM-B, PGAMA

UniProt

Q8N0Y7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PGAM1 Rabbit Polyclonal Antibody (orb585156) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002620

Preservative

Lyophilized powder

AA Sequence

HPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Antigen (CD44) Antibody
abx415170 250 µg

CD44 Antigen (CD44) Antibody

Sign In for Pricing
View Details
Recombinant Human Adiponectin/ACRP30/ADIPOQ Protein, N-His
YHH22001 100 μg

Recombinant Human Adiponectin/ACRP30/ADIPOQ Protein, N-His

Sign In for Pricing
View Details
Retinoblastoma binding protein 1 (ARID4A) (NM_002892) Human Over-expression Lysate
LS005926-20ug 20 µg

Retinoblastoma binding protein 1 (ARID4A) (NM_002892) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Monoclonal RUVBL2 Antibody (OTI2B9) [Alexa Fluor 532]
NBP2-73960AF532 0.1 mL

Mouse Monoclonal RUVBL2 Antibody (OTI2B9) [Alexa Fluor 532]

Sign In for Pricing
View Details
GYPC Antibody
orb1260973 100 µL

GYPC Antibody

Sign In for Pricing
View Details
Zfp790 Protein Vector (Mouse) (pPB-C-His)
PV250262 500 ng

Zfp790 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details