PGM1 Peptide - middle region
PGM1 Peptide - middle region
Product Specifications
Product Name Alternative
GSD14
UniProt
P36871
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PGM1 Rabbit Polyclonal Antibody (orb583137) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002624
Preservative
Lyophilized powder
AA Sequence
TVEKADNFEYSDPVDGSISRNQGLRLIFTDGSRIVFRLSGTGSAGATIRL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
218493-01 50 µg
QKI, Recombinant, Human, aa1-341, His-Tag (Protein Quaking Isoform HQK-5)
Sign In for Pricing
View Details 218493-02 250 µg
QKI, Recombinant, Human, aa1-341, His-Tag (Protein Quaking Isoform HQK-5)
Sign In for Pricing
View Details 
MBS644095-01 0.1 mL
ULK1, phosphorylated (Ser555) (Serine/Threonine-protein Kinase ULK1, Unc-51-like Kinase 1, KIAA0722)
Sign In for Pricing
View Details MBS644095-02 5x 0.1 mL
ULK1, phosphorylated (Ser555) (Serine/Threonine-protein Kinase ULK1, Unc-51-like Kinase 1, KIAA0722)
Sign In for Pricing
View Details 