PGM1 Peptide - middle region
PGM1 Peptide - middle region
Product Specifications
Product Name Alternative
GSD14
UniProt
P36871
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PGM1 Rabbit Polyclonal Antibody (orb583137) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002624
Preservative
Lyophilized powder
AA Sequence
TVEKADNFEYSDPVDGSISRNQGLRLIFTDGSRIVFRLSGTGSAGATIRL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2159588-01 96 Tests
Ectodysplasin A2 Receptor (EDA2R) Magnetic Fluorescence Assay Kit
Sign In for Pricing
View Details MBS2159588-02 5x 96 Tests
Ectodysplasin A2 Receptor (EDA2R) Magnetic Fluorescence Assay Kit
Sign In for Pricing
View Details MBS2159588-03 10x 96 Tests
Ectodysplasin A2 Receptor (EDA2R) Magnetic Fluorescence Assay Kit
Sign In for Pricing
View Details 
A00582-Fluoro550 100 µg/Vial
Anti-UBE3A Picoband® Antibody Fluoro550 Conjugated
Sign In for Pricing
View Details MBS2701375-01 24 Strip Well
Gallus Vascular Endothelial Growth Factor A (VEGFA) ELISA Kit
Sign In for Pricing
View Details MBS2701375-02 48 Well
Gallus Vascular Endothelial Growth Factor A (VEGFA) ELISA Kit
Sign In for Pricing
View Details