Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGM5 Peptide - N-terminal region

PGM5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PGMRP

UniProt

Q15124

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PGM5 Rabbit Polyclonal Antibody (orb584941) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068800

Preservative

Lyophilized powder

AA Sequence

IPVLTVPTAPYEDQRPAGGGGLRRPTGLFEGQRNYLPNFIQSVLSSIDLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Aminoacridone *CAS 27918-14-5*
604-AAT 25 mg

2-Aminoacridone *CAS 27918-14-5*

Sign In for Pricing
View Details
BAD (Ab-136) Antibody
8B7021-AAT 50 µg

BAD (Ab-136) Antibody

Sign In for Pricing
View Details
beta Actin (ACTB) Goat Polyclonal Antibody
AB0145-200 600 µg

beta Actin (ACTB) Goat Polyclonal Antibody

Sign In for Pricing
View Details
(±)-Alpha-Bisabolol-d3 (racemic and diastereomeric mixture)
TRC-B399808-5MG 5 mg

(±)-Alpha-Bisabolol-d3 (racemic and diastereomeric mixture)

Sign In for Pricing
View Details
MiTF Recombinant Rabbit monoclonal Antibody
HA750362 100 µL

MiTF Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
GCHFR Antibody
8C15997-AAT 50 µg

GCHFR Antibody

Sign In for Pricing
View Details