Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGM5 Peptide - N-terminal region

PGM5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PGMRP

UniProt

Q15124

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PGM5 Rabbit Polyclonal Antibody (orb584941) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068800

Preservative

Lyophilized powder

AA Sequence

IPVLTVPTAPYEDQRPAGGGGLRRPTGLFEGQRNYLPNFIQSVLSSIDLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMIM15 (NM_001048249) Human Over-expression Lysate
LC420794 20 µg

SMIM15 (NM_001048249) Human Over-expression Lysate

Sign In for Pricing
View Details
RBM24 (NM_001143942) Human Over-expression Lysate
LY428414 100 µg

RBM24 (NM_001143942) Human Over-expression Lysate

Sign In for Pricing
View Details
1-Boc-hexahydro-1,4-diazepine
TRC-B656175-2G 2 g

1-Boc-hexahydro-1,4-diazepine

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD197 Antibody[G043H7]
E-AB-F11590 100 µg

AF/LE Purified Anti-Human CD197 Antibody[G043H7]

Sign In for Pricing
View Details
Glycyl-L-Tyrosine Dihydrate
TRC-G765040-2.5G 2.5 g

Glycyl-L-Tyrosine Dihydrate

Sign In for Pricing
View Details
Recombinant Mouse CXCL12/SDF-1 Protein
PKSM040993-01 20 µg

Recombinant Mouse CXCL12/SDF-1 Protein

Sign In for Pricing
View Details