Pgr Peptide - middle region
Pgr Peptide - middle region
Product Specifications
Product Name Alternative
9930019P03Rik, NR3C3, PR, PR-A, PR-B, BB114106, ENSMUSG00000074510
UniProt
A6H6A5
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Pgr Rabbit Polyclonal Antibody (orb576158) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_032855
Preservative
Lyophilized powder
AA Sequence
SGSAHWPGAGVKPSPQPAAGEVEEDSGLETEGSAAPLLKSKPRALEGTGS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1257730-01 0.02 mg (E-Coli)
Recombinant Escherichia coli Putative selenoprotein ydfZ (ydfZ)
Sign In for Pricing
View Details MBS1257730-02 0.1 mg (E-Coli)
Recombinant Escherichia coli Putative selenoprotein ydfZ (ydfZ)
Sign In for Pricing
View Details MBS1257730-03 0.02 mg (Yeast)
Recombinant Escherichia coli Putative selenoprotein ydfZ (ydfZ)
Sign In for Pricing
View Details MBS1257730-04 0.1 mg (Yeast)
Recombinant Escherichia coli Putative selenoprotein ydfZ (ydfZ)
Sign In for Pricing
View Details