Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phactr3 Peptide - middle region

Phactr3 Peptide - middle region

Product Specifications

Product Name Alternative

1500003N10Rik, 4930415A02Rik, H17739, KIAA4224, SCAPIN1, mKIAA4224, scapinin, Scapin1, Scapinin

UniProt

Q6KCA9

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Phactr3 Rabbit Polyclonal Antibody (orb582076) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007155

Preservative

Lyophilized powder

AA Sequence

VTTVHRPLPPSRVMEELHRALATKHRQDSFQGRECRGSPKKRMDVRLSRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R)-1-(Benzyloxy)propan-2-ol
TRC-B287760-5G 5 g

(R)-1-(Benzyloxy)propan-2-ol

Sign In for Pricing
View Details
Polystyrene Triphenylphosphine
HR10031-0.25G 25 g

Polystyrene Triphenylphosphine

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD8a Antibody[HIT8a]
E-AB-F1271M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD8a Antibody[HIT8a]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD8a Antibody[HIT8a]
E-AB-F1271M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD8a Antibody[HIT8a]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD8a Antibody[HIT8a]
E-AB-F1271M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD8a Antibody[HIT8a]

Sign In for Pricing
View Details
5-Bromobenzofuran-2-carboxamide
TRC-B680235-50MG 50 mg

5-Bromobenzofuran-2-carboxamide

Sign In for Pricing
View Details