Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phactr3 Peptide - middle region

Phactr3 Peptide - middle region

Product Specifications

Product Name Alternative

1500003N10Rik, 4930415A02Rik, H17739, KIAA4224, SCAPIN1, mKIAA4224, scapinin, Scapin1, Scapinin

UniProt

Q6KCA9

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Phactr3 Rabbit Polyclonal Antibody (orb582076) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007155

Preservative

Lyophilized powder

AA Sequence

VTTVHRPLPPSRVMEELHRALATKHRQDSFQGRECRGSPKKRMDVRLSRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (MACIF/629), CF594 conjugate, 0.1mg/mL
BNC940629-100 1x 100 µL

CD59 (heavy chain of Protectin) (MACIF/629), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CAMK2G (NM_001222) Human Over-expression Lysate
LC420064 20 µg

CAMK2G (NM_001222) Human Over-expression Lysate

Sign In for Pricing
View Details
6-Iodo-nicotinic Acid
TRC-I715738-50MG 50 mg

6-Iodo-nicotinic Acid

Sign In for Pricing
View Details
GARNL1 (RALGAPA1) Rabbit Monoclonal Antibody [Clone ID: R02-4K-8]
TA421999 100 µL

GARNL1 (RALGAPA1) Rabbit Monoclonal Antibody [Clone ID: R02-4K-8]

Sign In for Pricing
View Details
Tissue FFPE Sections, Thymus
CS710400 5x 5 µm

Tissue FFPE Sections, Thymus

Sign In for Pricing
View Details
Recombinant IKZF3 Antibody
RC-5760-01 50 μL

Recombinant IKZF3 Antibody

Sign In for Pricing
View Details