PHF13 Peptide - middle region
PHF13 Peptide - middle region
Product Specifications
Product Name Alternative
MGC43399, PHF5, SPOC1
UniProt
Q86YI8
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PHF13 Rabbit Polyclonal Antibody (orb581309) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_722519
Preservative
Lyophilized powder
AA Sequence
GSCATVSPDQVKEIKTEGKRTIVRQGKQVVFRDEDSTGNDEDIMVDSDDD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS8586015-01 0.1 mg
IGF-I Receptor beta (phospho-Tyr1135) rabbit pAb
Sign In for Pricing
View Details MBS8586015-02 0.1 mL (AF405L)
IGF-I Receptor beta (phospho-Tyr1135) rabbit pAb
Sign In for Pricing
View Details MBS8586015-03 0.1 mL (AF405S)
IGF-I Receptor beta (phospho-Tyr1135) rabbit pAb
Sign In for Pricing
View Details MBS8586015-04 0.1 mL (AF610)
IGF-I Receptor beta (phospho-Tyr1135) rabbit pAb
Sign In for Pricing
View Details MBS8586015-05 0.1 mL (AF635)
IGF-I Receptor beta (phospho-Tyr1135) rabbit pAb
Sign In for Pricing
View Details