Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHF13 Peptide - middle region

PHF13 Peptide - middle region

Product Specifications

Product Name Alternative

MGC43399, PHF5, SPOC1

UniProt

Q86YI8

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHF13 Rabbit Polyclonal Antibody (orb581309) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_722519

Preservative

Lyophilized powder

AA Sequence

GSCATVSPDQVKEIKTEGKRTIVRQGKQVVFRDEDSTGNDEDIMVDSDDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Lymphocyte antigen T1/Leu 1, p56 62, T cell surface glycoprotein CD5, T1) (MaxLight 490)
C2256-03E-ML490 100 µL

CD5 (Lymphocyte antigen T1/Leu 1, p56 62, T cell surface glycoprotein CD5, T1) (MaxLight 490)

Sign In for Pricing
View Details
SAA4 (11R1) Rabbit Monoclonal Antibody
AMRe17567-01 50 µL

SAA4 (11R1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SAA4 (11R1) Rabbit Monoclonal Antibody
AMRe17567-02 100 µL

SAA4 (11R1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SAA4 (11R1) Rabbit Monoclonal Antibody
AMRe17567-03 200 µL

SAA4 (11R1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SARA Rabbit mAb
RDSA66305 100 µL

SARA Rabbit mAb

Sign In for Pricing
View Details
Phospho-c-Cbl (Tyr700) Rabbit pAb
orb2715633-01 50 µL

Phospho-c-Cbl (Tyr700) Rabbit pAb

Sign In for Pricing
View Details