Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHLDA2 Peptide - N-terminal region

PHLDA2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BRW1C, BWR1C, HLDA2, IPL, TSSC3

UniProt

Q53GA4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHLDA2 Rabbit Polyclonal Antibody (orb583928) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003302

Preservative

Lyophilized powder

AA Sequence

MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 450 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842Q-01 20 Tests

Elab Fluor® Violet 450 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842Q-02 100 Tests

Elab Fluor® Violet 450 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842Q-03 2x 100 Tests

Elab Fluor® Violet 450 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
CYLD Human Gene Knockout Kit (CRISPR)
KN204099LP 1 Kit

CYLD Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DAK Antibody
8C11155-AAT 50 µg

DAK Antibody

Sign In for Pricing
View Details
CD45 / LCA (135-4C5), Biotin conjugate, 0.1mg/mL
BNCB0172-500 1x 500 µL

CD45 / LCA (135-4C5), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details