Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHOSPHO2 Peptide - N-terminal region

PHOSPHO2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC111048, MGC22679

UniProt

Q8TCD6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHOSPHO2 Rabbit Polyclonal Antibody (orb577512) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008489

Preservative

Lyophilized powder

AA Sequence

MKILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSAG3 Rabbit Polyclonal Antibody
AP05264SU-N 100 µg

CSAG3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
nephronectin (NPNT) Human Gene Knockout Kit (CRISPR)
KN416417 1 Kit

nephronectin (NPNT) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3,3',5-Triiodo Thyroacetic Acid-13C6
TRC-T795322-1MG 1 mg

3,3',5-Triiodo Thyroacetic Acid-13C6

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS706149 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Cisd1 (NM_134007) Mouse Tagged ORF Clone
MG200391 10 µg

Cisd1 (NM_134007) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS709445 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details