Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHOSPHO2 Peptide - N-terminal region

PHOSPHO2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC111048, MGC22679

UniProt

Q8TCD6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHOSPHO2 Rabbit Polyclonal Antibody (orb577512) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008489

Preservative

Lyophilized powder

AA Sequence

MKILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPSA Polyclonal Antibody
E-AB-14216-01 20 µL

RPSA Polyclonal Antibody

Sign In for Pricing
View Details
RPSA Polyclonal Antibody
E-AB-14216-02 60 µL

RPSA Polyclonal Antibody

Sign In for Pricing
View Details
RPSA Polyclonal Antibody
E-AB-14216-03 120 µL

RPSA Polyclonal Antibody

Sign In for Pricing
View Details
RPSA Polyclonal Antibody
E-AB-14216-04 200 µL

RPSA Polyclonal Antibody

Sign In for Pricing
View Details
PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2716), Biotin conjugate, 0.1mg/mL
BNCB2716-500 1x 500 µL

PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2716), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human METTL27 activation kit by CRISPRa
GA115913 1 Kit

Human METTL27 activation kit by CRISPRa

Sign In for Pricing
View Details