Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIGC Peptide - C-terminal region

PIGC Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPI2, MGC2049

UniProt

Q92535

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIGC Rabbit Polyclonal Antibody (orb326371) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002633

Preservative

Lyophilized powder

AA Sequence

AVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EASYStep Pro Chicken Corticosterone (Cort) ELISA Kit
RDEp-Cort-Ch 96 Tests

EASYStep Pro Chicken Corticosterone (Cort) ELISA Kit

Sign In for Pricing
View Details
RMND5A Rabbit Polyclonal Antibody
TA366013 100 µL

RMND5A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GCSF Receptor (CSF3R) (Center) Rabbit Polyclonal Antibody
AP51098PU-N 400 µL

GCSF Receptor (CSF3R) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-(1,4-Dihydro-2,4-dioxo-3(2H)-quinazolinyl)-benzeneacetic Acid
TRC-D975410-100MG 100 mg

4-(1,4-Dihydro-2,4-dioxo-3(2H)-quinazolinyl)-benzeneacetic Acid

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD14 Antibody[M5E2]
E-AB-F1209H-01 20 Tests

PE/Cyanine7 Anti-Human CD14 Antibody[M5E2]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD14 Antibody[M5E2]
E-AB-F1209H-02 100 Tests

PE/Cyanine7 Anti-Human CD14 Antibody[M5E2]

Sign In for Pricing
View Details