Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIGC Peptide - C-terminal region

PIGC Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPI2, MGC2049

UniProt

Q92535

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIGC Rabbit Polyclonal Antibody (orb326371) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002633

Preservative

Lyophilized powder

AA Sequence

AVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENPP3 Human Gene Knockout Kit (CRISPR)
KN424818 1 Kit

ENPP3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Rhod activation kit by CRISPRa
GA200275 1 Kit

Mouse Rhod activation kit by CRISPRa

Sign In for Pricing
View Details
Phalloidin
sc-202763 1 mg

Phalloidin

Sign In for Pricing
View Details
Octadecanedioic acid monoethyl ester
TRC-O362660-2.5G 2.5 g

Octadecanedioic acid monoethyl ester

Sign In for Pricing
View Details
LY6K Antibody
KC-3867-01 50 μL

LY6K Antibody

Sign In for Pricing
View Details
LY6K Antibody
KC-3867-02 100 µL

LY6K Antibody

Sign In for Pricing
View Details