Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIGL Peptide - N-terminal region

PIGL Peptide - N-terminal region

Product Specifications

Product Name Alternative

CHIME

UniProt

Q9Y2B2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIGL Rabbit Polyclonal Antibody (orb579786) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004269

Preservative

Lyophilized powder

AA Sequence

MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurofilament (NF-H) (NF421), CF740 conjugate, 0.1mg/mL
BNC740421-100 1x 100 µL

Neurofilament (NF-H) (NF421), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Human TIMP-4 (Tissue Inhibitors of Metalloproteinase 4) ELISA Kit
E-UNEL-H0298-01 5x 96 Tests

Uncoated Human TIMP-4 (Tissue Inhibitors of Metalloproteinase 4) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human TIMP-4 (Tissue Inhibitors of Metalloproteinase 4) ELISA Kit
E-UNEL-H0298-02 15x 96 Tests

Uncoated Human TIMP-4 (Tissue Inhibitors of Metalloproteinase 4) ELISA Kit

Sign In for Pricing
View Details
CD45RB (PD7/26), CF647 conjugate, 0.1mg/mL
BNC470472-100 1x 100 µL

CD45RB (PD7/26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pole3 (NM_021498) Mouse Tagged ORF Clone
MG200969 10 µg

Pole3 (NM_021498) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS645979 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details