Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIGL Peptide - N-terminal region

PIGL Peptide - N-terminal region

Product Specifications

Product Name Alternative

CHIME

UniProt

Q9Y2B2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIGL Rabbit Polyclonal Antibody (orb579786) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004269

Preservative

Lyophilized powder

AA Sequence

MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD99 (MIC2/877), CF488A conjugate, 0.1mg/mL
BNC880877-100 1x 100 µL

CD99 (MIC2/877), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Palladin Antibody
KC-1071-01 50 μL

Palladin Antibody

Sign In for Pricing
View Details
Palladin Antibody
KC-1071-02 100 µL

Palladin Antibody

Sign In for Pricing
View Details
Palladin Antibody
KC-1071-03 1 mL

Palladin Antibody

Sign In for Pricing
View Details
Cytokeratin, HMW (34BE12), 0.2mg/mL
BNUB0446-100 1x 100 µL

Cytokeratin, HMW (34BE12), 0.2mg/mL

Sign In for Pricing
View Details
CYCSP55 Human qPCR Primer Pair (NR_001561)
HP219945 200 Reactions

CYCSP55 Human qPCR Primer Pair (NR_001561)

Sign In for Pricing
View Details