PIGQ Peptide - N-terminal region
PIGQ Peptide - N-terminal region
Product Specifications
Product Name Alternative
GPI1, MGC12693, c407A10.1, hGPI1
UniProt
Q9BRB3
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PIGQ Rabbit Polyclonal Antibody (orb325271) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_683721
Preservative
Lyophilized powder
AA Sequence
VLHFPFIPIQVKQLLAQVRQASQVGVAVLGTWCHCRQEPEESLGRFLESL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941037-500 1x 500 µL
CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740149-500 1x 500 µL
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470031-500 1x 500 µL
Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940669-500 1x 500 µL
P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details