Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pigs Peptide - C-terminal region

Pigs Peptide - C-terminal region

Product Specifications

Product Name Alternative

BC058979, Gm393, Gm689

UniProt

Q6PD26

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pigs Rabbit Polyclonal Antibody (orb581000) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_958808

Preservative

Lyophilized powder

AA Sequence

AVAAVQKAAKALALGHLSSAFAASQEAVTSSERAFFDPSLLHLLYFPDDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Colon: right
CB528439 1 Block

Frozen Tissue Blocks, Colon: right

Sign In for Pricing
View Details
Human OR5AC2 activation kit by CRISPRa
GA113019 1 Kit

Human OR5AC2 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS707752 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
TSEN2 (NM_025265) Human Recombinant Protein
TP305156L 1 mg

TSEN2 (NM_025265) Human Recombinant Protein

Sign In for Pricing
View Details
Ivuxolimab Biosimilar - Research Grade
ICH5119-20mg 20 mg

Ivuxolimab Biosimilar - Research Grade

Sign In for Pricing
View Details
1-Octanesulfonic Acid Sodium Salt
TRC-O237575-50G 50 g

1-Octanesulfonic Acid Sodium Salt

Sign In for Pricing
View Details