Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pigs Peptide - C-terminal region

Pigs Peptide - C-terminal region

Product Specifications

Product Name Alternative

BC058979, Gm393, Gm689

UniProt

Q6PD26

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pigs Rabbit Polyclonal Antibody (orb581000) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_958808

Preservative

Lyophilized powder

AA Sequence

AVAAVQKAAKALALGHLSSAFAASQEAVTSSERAFFDPSLLHLLYFPDDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIPK4 Rabbit Polyclonal Antibody
AP52050PU-N 400 µL

HIPK4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sgca Mouse Gene Knockout Kit (CRISPR)
KN515673 1 Kit

Sgca Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pentanoic-2,2-d2 Acid
TRC-V091416-50MG 50 mg

Pentanoic-2,2-d2 Acid

Sign In for Pricing
View Details
Caspase-1 Microplate Assay Kit
RDSM192 100 Assays

Caspase-1 Microplate Assay Kit

Sign In for Pricing
View Details
N-(4,4-Diethoxybutyl)-N-ethylnitrous Amide
TRC-D126480-250MG 250 mg

N-(4,4-Diethoxybutyl)-N-ethylnitrous Amide

Sign In for Pricing
View Details
RPL4 Rabbit Polyclonal Antibody
TA381066 100 µL

RPL4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details