Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIGX Peptide - C-terminal region

PIGX Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ20522

UniProt

A8MSL3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIGX Rabbit Polyclonal Antibody (orb584827) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060331

Preservative

Lyophilized powder

AA Sequence

AAPCALENEDICQWNKMKYKSVYKNVILQVPVGLTVHTSLVCSVTLLITI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cis-Vaccenic acid
HY-113427A-01 25 mg (1.77 M x 0.05 mL in Ethanol)

Cis-Vaccenic acid

Sign In for Pricing
View Details
Cis-Vaccenic acid
HY-113427A-02 50 mg (1.77 M x 0.1 mL in Ethanol)

Cis-Vaccenic acid

Sign In for Pricing
View Details
Cis-Vaccenic acid
HY-113427A-03 100 mg (1.77 M x 0.2 mL in Ethanol)

Cis-Vaccenic acid

Sign In for Pricing
View Details
Narf (NM_026272) Mouse Tagged ORF Clone Lentiviral Particle
MR207374L3V 200 µL

Narf (NM_026272) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Anti ALOX15B Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)
MBS8422390-01 0.001 mL

Rabbit Anti ALOX15B Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)

Sign In for Pricing
View Details
Rabbit Anti ALOX15B Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)
MBS8422390-02 5x 0.001 mL

Rabbit Anti ALOX15B Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)

Sign In for Pricing
View Details