Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIGX Peptide - C-terminal region

PIGX Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ20522

UniProt

A8MSL3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIGX Rabbit Polyclonal Antibody (orb584827) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060331

Preservative

Lyophilized powder

AA Sequence

AAPCALENEDICQWNKMKYKSVYKNVILQVPVGLTVHTSLVCSVTLLITI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lumateperone Impurity 13
RM-L212013-01 10 mg

Lumateperone Impurity 13

Sign In for Pricing
View Details
Lumateperone Impurity 13
RM-L212013-02 25 mg

Lumateperone Impurity 13

Sign In for Pricing
View Details
Lumateperone Impurity 13
RM-L212013-03 50 mg

Lumateperone Impurity 13

Sign In for Pricing
View Details
Lumateperone Impurity 13
RM-L212013-04 100 mg

Lumateperone Impurity 13

Sign In for Pricing
View Details
Factor I (CFI) (NM_000204) Human Tagged ORF Clone Lentiviral Particle
RC216645L2V 200 µL

Factor I (CFI) (NM_000204) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human Serum albumin Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-0945R-APC-Cy5.5 100 µL

Human Serum albumin Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details