Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PINX1 Peptide - middle region

PINX1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ20565, LPTL, LPTS, MGC8850

UniProt

Q96BK5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PINX1 Rabbit Polyclonal Antibody (orb330912) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060354

Preservative

Lyophilized powder

AA Sequence

EKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CTLA4 Protein (His Tag)
PKSM041001-01 10 µg

Recombinant Mouse CTLA4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse CTLA4 Protein (His Tag)
PKSM041001-02 50 µg

Recombinant Mouse CTLA4 Protein (His Tag)

Sign In for Pricing
View Details
LAP3 Human Knockdown Lysate
LY300364 100 µg

LAP3 Human Knockdown Lysate

Sign In for Pricing
View Details
Zfp185 Mouse Gene Knockout Kit (CRISPR)
KN519744 1 Kit

Zfp185 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mitochondrial Marker (MTC754), CF640R conjugate, 0.1mg/mL
BNC400754-100 1x 100 µL

Mitochondrial Marker (MTC754), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3092), CF568 conjugate, 0.1mg/mL
BNC683092-500 1x 500 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3092), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details