Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PINX1 Peptide - middle region

PINX1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ20565, LPTL, LPTS, MGC8850

UniProt

Q96BK5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PINX1 Rabbit Polyclonal Antibody (orb330912) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060354

Preservative

Lyophilized powder

AA Sequence

EKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), CF647 conjugate, 0.1mg/mL
BNC472044-500 1x 500 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GPR91 (SUCNR1) (NM_033050) Human Over-expression Lysate
LY403217 100 µg

GPR91 (SUCNR1) (NM_033050) Human Over-expression Lysate

Sign In for Pricing
View Details
Bax (2D2), CF594 conjugate, 0.1mg/mL
BNC940004-500 1x 500 µL

Bax (2D2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD57 Antibody[HI57a]
E-AB-F1333G-01 20 Tests

PE/Cyanine5 Anti-Human CD57 Antibody[HI57a]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD57 Antibody[HI57a]
E-AB-F1333G-02 100 Tests

PE/Cyanine5 Anti-Human CD57 Antibody[HI57a]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD57 Antibody[HI57a]
E-AB-F1333G-03 2x 100 Tests

PE/Cyanine5 Anti-Human CD57 Antibody[HI57a]

Sign In for Pricing
View Details