Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pitx1 Peptide - middle region

Pitx1 Peptide - middle region

Product Specifications

Product Name Alternative

Bft

UniProt

Q99NA7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pitx1 Rabbit Polyclonal Antibody (orb574472) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_446076

Preservative

Lyophilized powder

AA Sequence

LCKGGYVPQFSGLVQPYEDVYAAAGYSYNNWAAKSLAPAPLSTKSFTFFN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DQA1 (HLA Class II Histocompatibility Antigen, DQ alpha 1 Chain, DC-1 alpha Chain, DC-alpha, HLA-DCA, MHC Class II DQA1) (MaxLight 490)
MBS6201227-01 0.1 mL

HLA-DQA1 (HLA Class II Histocompatibility Antigen, DQ alpha 1 Chain, DC-1 alpha Chain, DC-alpha, HLA-DCA, MHC Class II DQA1) (MaxLight 490)

Sign In for Pricing
View Details
HLA-DQA1 (HLA Class II Histocompatibility Antigen, DQ alpha 1 Chain, DC-1 alpha Chain, DC-alpha, HLA-DCA, MHC Class II DQA1) (MaxLight 490)
MBS6201227-02 5x 0.1 mL

HLA-DQA1 (HLA Class II Histocompatibility Antigen, DQ alpha 1 Chain, DC-1 alpha Chain, DC-alpha, HLA-DCA, MHC Class II DQA1) (MaxLight 490)

Sign In for Pricing
View Details
PALS1 Human Over-expression Lysate
orb1370876 20 µg

PALS1 Human Over-expression Lysate

Sign In for Pricing
View Details
SLC35F3 Rabbit Polyclonal Antibody
orb1880811-01 30 µL

SLC35F3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC35F3 Rabbit Polyclonal Antibody
orb1880811-02 50 µL

SLC35F3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC35F3 Rabbit Polyclonal Antibody
orb1880811-03 100 µL

SLC35F3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details